Lineage for d2qnhk1 (2qnh k:3-100)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029014Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 1029015Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 1029016Protein Ribosomal protein S10 [55001] (2 species)
  7. 1029042Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
    Uniprot P80375
  8. 1029082Domain d2qnhk1: 2qnh k:3-100 [150934]
    Other proteins in same PDB: d2qnhc1, d2qnhe1, d2qnhf1, d2qnhg1, d2qnhh1, d2qnhi1, d2qnhj1, d2qnhl1, d2qnhm1, d2qnhn1, d2qnho1, d2qnhp1, d2qnhq1, d2qnhr1, d2qnhs1, d2qnht1, d2qnhu1, d2qnhv1
    automatically matched to d1fjgj_

Details for d2qnhk1

PDB Entry: 2qnh (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 2QNH, contains the 30S ribosome subunit, two TRNA, and MRNA molecules. 50S ribosome subunit is in the file 1VSP.
PDB Compounds: (k:) 30S ribosomal protein S10

SCOPe Domain Sequences for d2qnhk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qnhk1 d.58.15.1 (k:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOPe Domain Coordinates for d2qnhk1:

Click to download the PDB-style file with coordinates for d2qnhk1.
(The format of our PDB-style files is described here.)

Timeline for d2qnhk1: