Lineage for d2qnhe1 (2qnh e:2-209)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199510Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 2199511Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 2199512Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 2199513Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 2199544Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)
  8. 2199581Domain d2qnhe1: 2qnh e:2-209 [150928]
    Other proteins in same PDB: d2qnhc1, d2qnhf1, d2qnhg1, d2qnhh1, d2qnhi1, d2qnhj1, d2qnhk1, d2qnhl1, d2qnhm1, d2qnhn1, d2qnho1, d2qnhp1, d2qnhq1, d2qnhr1, d2qnhs1, d2qnht1, d2qnhu1, d2qnhv1

Details for d2qnhe1

PDB Entry: 2qnh (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 2QNH, contains the 30S ribosome subunit, two TRNA, and MRNA molecules. 50S ribosome subunit is in the file 1VSP.
PDB Compounds: (e:) 30S ribosomal protein S4

SCOPe Domain Sequences for d2qnhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qnhe1 d.66.1.2 (e:2-209) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOPe Domain Coordinates for d2qnhe1:

Click to download the PDB-style file with coordinates for d2qnhe1.
(The format of our PDB-style files is described here.)

Timeline for d2qnhe1: