SCOP 1.75: Domain d2qn6a3: 2qn6 A:2-206

Lineage for d2qn6a3 (2qn6 A:2-206)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species)
   includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family ((144211))
   includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family ((144211))

7. Species Sulfolobus solfataricus [TaxId:2287] [142227] (5 PDB entries)
   Uniprot Q980A5 2-206

8. Domain d2qn6a3: 2qn6 A:2-206 [150913]
   Other proteins in same PDB: d2qn6a1, d2qn6a2, d2qn6b1
   automatically matched to d2ahoa3
   complexed with gdp, mg

Details for d2qn6a3

PDB Entry: 2qn6, 2.15 Å

PDB Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states

PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOP Domain Sequences for d2qn6a3:

Sequence, based on SEQRES records:

>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
pvsalhkinidsliegieeyiktpy

Sequence, based on observed residues (ATOM records):

>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]}
awpkvqpevnigvvghvdhgkttlvqaitgiwtlgyaetnigvcesckkpeayvtepsck
scgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaanepfpqpqtrehfva
lgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpiipvsalhkinidsli
egieeyiktpy

Timeline for d2qn6a3:

• d2qn6a3 is new in SCOP 1.75
  
• d2qn6a3 appears in SCOPe 2.01
  
• d2qn6a3 appears in the current release, SCOPe 2.08