SCOPe 2.05: Domain d2qn6a2: 2qn6 A:321-415

Lineage for d2qn6a2 (2qn6 A:321-415)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)

6. Protein Initiation factor eIF2 gamma subunit [74964] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [141344] (10 PDB entries)
   Uniprot Q980A5 321-415

8. Domain d2qn6a2: 2qn6 A:321-415 [150912]
   Other proteins in same PDB: d2qn6a1, d2qn6a3, d2qn6b_
   automated match to d2ahoa2
   complexed with gdp, mg

Details for d2qn6a2

PDB Entry: 2qn6, 2.15 Å

PDB Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states

PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOPe Domain Sequences for d2qn6a2:

Sequence, based on SEQRES records:

>d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

Sequence, based on observed residues (ATOM records):

>d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]}
aevpvlwnirikynllervvvdpiraketlmlsvgssttlgivtsvkkdeievelrrpva
vwsnnirtvisrqiagrwrmigwglvei

Timeline for d2qn6a2:

• d2qn6a2 first appeared in SCOP 1.75
  
• d2qn6a2 appears in SCOPe 2.04
  
• d2qn6a2 appears in SCOPe 2.06
  
• d2qn6a2 appears in the current release, SCOPe 2.08