SCOPe 2.08: Domain d2qn6a1: 2qn6 A:207-320

Lineage for d2qn6a1 (2qn6 A:207-320)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.1: Elongation factors [50448] (11 proteins)

6. Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [141335] (10 PDB entries)
   Uniprot Q980A5 207-320

8. Domain d2qn6a1: 2qn6 A:207-320 [150911]
   Other proteins in same PDB: d2qn6a2, d2qn6a3, d2qn6b_
   automated match to d2ahoa1
   complexed with gdp, mg

Details for d2qn6a1

PDB Entry: 2qn6, 2.15 Å

PDB Description: Structure of an archaeal heterotrimeric initiation factor 2 reveals a nucleotide state between the GTP and the GDP states

PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOPe Domain Sequences for d2qn6a1:

Sequence; same for both SEQRES and ATOM records:

>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

Timeline for d2qn6a1:

• d2qn6a1 first appeared in SCOP 1.75
  
• d2qn6a1 appears in SCOPe 2.07