Lineage for d2qmva1 (2qmv A:207-476)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 proteins)
  6. 776796Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 776797Species Human (Homo sapiens) [TaxId:9606] [48525] (46 PDB entries)
    Uniprot P37231 232-505
  8. 776878Domain d2qmva1: 2qmv A:207-476 [150898]
    automatically matched to d1wm0x_

Details for d2qmva1

PDB Entry: 2qmv (more details)

PDB Description: High Resolution Structure of Peroxisone Proliferation-Activated Receptor gamma and Characterisation of its Interaction with the Co-activator Transcriptional Intermediary Factor 2
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOP Domain Sequences for d2qmva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qmva1 a.123.1.1 (A:207-476) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

SCOP Domain Coordinates for d2qmva1:

Click to download the PDB-style file with coordinates for d2qmva1.
(The format of our PDB-style files is described here.)

Timeline for d2qmva1: