![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins) lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G) |
![]() | Protein SIP2 [158889] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [158890] (1 PDB entry) Uniprot P34164 161-247 |
![]() | Domain d2qlve1: 2qlv E:161-247 [150870] Other proteins in same PDB: d2qlva1, d2qlvb2, d2qlvd_, d2qlve2 automatically matched to 2QLV B:161-247 |
PDB Entry: 2qlv (more details), 2.6 Å
SCOPe Domain Sequences for d2qlve1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qlve1 b.1.18.21 (E:161-247) SIP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} slmvpveirwqqggskvyvtgsftkwrkmiglipdsdnngsfhvklrllpgthrfrfivd nelrvsdflptatdqmgnfvnyievrq
Timeline for d2qlve1:
![]() Domains from other chains: (mouse over for more information) d2qlva1, d2qlvb1, d2qlvb2, d2qlvd_ |