Lineage for d2qlvd1 (2qlv D:460-630)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872976Superfamily d.129.6: KA1-like [103243] (2 families) (S)
    contains a single copy of this fold
  5. 872982Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (3 proteins)
    PfamB PB166430
  6. 872988Protein Carbon catabolite-derepressing protein kinase SNF1 [160724] (1 species)
  7. 872989Species Saccharomyces cerevisiae [TaxId:4932] [160725] (1 PDB entry)
    Uniprot P06782 460-630
  8. 872991Domain d2qlvd1: 2qlv D:460-630 [150869]
    Other proteins in same PDB: d2qlvb1, d2qlvb2, d2qlve1, d2qlve2
    automatically matched to 2QLV A:460-630

Details for d2qlvd1

PDB Entry: 2qlv (more details), 2.6 Å

PDB Description: crystal structure of the heterotrimer core of the s. cerevisiae ampk homolog snf1
PDB Compounds: (D:) Carbon catabolite derepressing protein kinase

SCOP Domain Sequences for d2qlvd1:

Sequence, based on SEQRES records: (download)

>d2qlvd1 d.129.6.2 (D:460-630) Carbon catabolite-derepressing protein kinase SNF1 {Saccharomyces cerevisiae [TaxId: 4932]}
ykeedstvsilptslpqihranmlaqgspaaskisplvtkksktrwhfgirsrsypldvm
geiyialknlgaewakpseedlwtiklrwkydignktntnekipdlmkmviqlfqietnn
ylvdfkfdgwessygddttvsnisedemstfsaypflhlttklimelavns

Sequence, based on observed residues (ATOM records): (download)

>d2qlvd1 d.129.6.2 (D:460-630) Carbon catabolite-derepressing protein kinase SNF1 {Saccharomyces cerevisiae [TaxId: 4932]}
ykeedstvsilptslpqihranmlaqgspaaskisplvttrwhfgirsrsypldvmgeiy
ialknlgaewakpslwtiklrwkdlmkmviqlfqnnylvdfkfdgwesemstfsaypflh
lttklimelavns

SCOP Domain Coordinates for d2qlvd1:

Click to download the PDB-style file with coordinates for d2qlvd1.
(The format of our PDB-style files is described here.)

Timeline for d2qlvd1: