SCOPe 2.05: Domain d2qkyc2: 2qky C:509-766

Lineage for d2qkyc2 (2qky C:509-766)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (71 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188340] (51 PDB entries)

8. Domain d2qkyc2: 2qky C:509-766 [150854]
   Other proteins in same PDB: d2qkya1, d2qkyb1, d2qkyc1, d2qkyd1
   automated match to d4n8db2
   complexed with 13z

Details for d2qkyc2

PDB Entry: 2qky, 3.1 Å

PDB Description: complex structure of dipeptidyl peptidase iv and a oxadiazolyl ketone

PDB Compounds: (C:) Dipeptidyl peptidase 4 (EC 3.4.14.5) (Dipeptidyl peptidase IV) (DPP IV) (T-cell activation antigen CD26) (TP103) (Adenosine deaminase complexing protein 2) (ADABP) (Dipeptidyl peptidase 4 soluble form) (Dipeptidyl peptidase IV soluble form)

SCOPe Domain Sequences for d2qkyc2:

Sequence; same for both SEQRES and ATOM records:

>d2qkyc2 c.69.1.0 (C:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

Timeline for d2qkyc2:

• d2qkyc2 first appeared in SCOP 1.75
  
• d2qkyc2 appears in SCOPe 2.04
  
• d2qkyc2 appears in SCOPe 2.06
  
• d2qkyc2 appears in the current release, SCOPe 2.08