Lineage for d2qkyc2 (2qky C:509-766)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902215Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries)
  8. 2902422Domain d2qkyc2: 2qky C:509-766 [150854]
    Other proteins in same PDB: d2qkya1, d2qkya3, d2qkyb1, d2qkyb3, d2qkyc1, d2qkyc3, d2qkyd1, d2qkyd3
    automated match to d4n8db2
    complexed with 13z

Details for d2qkyc2

PDB Entry: 2qky (more details), 3.1 Å

PDB Description: complex structure of dipeptidyl peptidase iv and a oxadiazolyl ketone
PDB Compounds: (C:) Dipeptidyl peptidase 4 (EC 3.4.14.5) (Dipeptidyl peptidase IV) (DPP IV) (T-cell activation antigen CD26) (TP103) (Adenosine deaminase complexing protein 2) (ADABP) (Dipeptidyl peptidase 4 soluble form) (Dipeptidyl peptidase IV soluble form)

SCOPe Domain Sequences for d2qkyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qkyc2 c.69.1.0 (C:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d2qkyc2:

Click to download the PDB-style file with coordinates for d2qkyc2.
(The format of our PDB-style files is described here.)

Timeline for d2qkyc2: