SCOP 1.75: Domain d2qkac1: 2qka C:1-83

Lineage for d2qkac1 (2qka C:1-83)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46619] (27 PDB entries)

8. Domain d2qkac1: 2qka C:1-83 [150841]
   Other proteins in same PDB: d2qkaa2, d2qkac2
   automatically matched to d1em1a1
   complexed with mn; mutant

Details for d2qkac1

PDB Entry: 2qka, 2.2 Å

PDB Description: structural and kinetic study of the differences between human and e.coli manganese superoxide dismutases

PDB Compounds: (C:) Superoxide dismutase [Mn]

SCOP Domain Sequences for d2qkac1:

Sequence; same for both SEQRES and ATOM records:

>d2qkac1 a.2.11.1 (C:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkanggghinhsifwtnlsp

Timeline for d2qkac1:

• d2qkac1 is new in SCOP 1.75
  
• d2qkac1 appears in SCOPe 2.01
  
• d2qkac1 appears in the current release, SCOPe 2.08