SCOPe 2.06: Domain d2qi2a2: 2qi2 A:127-243

Lineage for d2qi2a2 (2qi2 A:127-243)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.2: ERF1/Dom34 middle domain-like [53143] (3 proteins)
   automatically mapped to Pfam PF03464

6. Protein Cell division protein pelota [159647] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [159648] (1 PDB entry)
   Uniprot Q9HJ74 127-243

8. Domain d2qi2a2: 2qi2 A:127-243 [150801]
   Other proteins in same PDB: d2qi2a1, d2qi2a3

Details for d2qi2a2

PDB Entry: 2qi2, 2.9 Å

PDB Description: Crystal structure of the Thermoplasma acidophilum Pelota protein

PDB Compounds: (A:) Cell division protein pelota related protein

SCOPe Domain Sequences for d2qi2a2:

Sequence, based on SEQRES records:

>d2qi2a2 c.55.4.2 (A:127-243) Cell division protein pelota {Thermoplasma acidophilum [TaxId: 2303]}
ekyvtvytavamdedeaqiflihpygiqqvgtvysgrsgkyaegnyseasyfdqivnalk
nysnsiiilgpgfardrfarycaqrgvnvigsfpanrtdsgavyefitsadgaklls

Sequence, based on observed residues (ATOM records):

>d2qi2a2 c.55.4.2 (A:127-243) Cell division protein pelota {Thermoplasma acidophilum [TaxId: 2303]}
ekyvtvytavamdedeaqiflihpygiqqvgtvysgrsgkyyseasyfdqivnalknysn
siiilgpgfardrfarycaqrgvnvigsfpanrtdsgavyefitsadgaklls

Timeline for d2qi2a2:

• d2qi2a2 first appeared in SCOP 1.75
  
• d2qi2a2 appears in SCOPe 2.05
  
• d2qi2a2 appears in SCOPe 2.07
  
• d2qi2a2 appears in the current release, SCOPe 2.08