SCOP 1.75: Domain d2qhbb1: 2qhb B:578-659

Lineage for d2qhbb1 (2qhb B:578-659)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (19 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (15 proteins)

6. Protein Telomere binding protein TBP1 [158244] (1 species)

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [158245] (2 PDB entries)
   Uniprot Q84ZU4 578-660

8. Domain d2qhbb1: 2qhb B:578-659 [150787]
   automatically matched to 2CKX A:578-660

Details for d2qhbb1

PDB Entry: 2qhb, 2.4 Å

PDB Description: crystal structure of ngtrf complexed with telomeric dna

PDB Compounds: (B:) telomere binding protein tbp1

SCOP Domain Sequences for d2qhbb1:

Sequence; same for both SEQRES and ATOM records:

>d2qhbb1 a.4.1.3 (B:578-659) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
rpfsvaevealveavehlgtgrwrdvkmrafdnadhrtyvdlkdkwktlvhtasiapqqr
rgepvpqdlldrvlaahaywsq

Timeline for d2qhbb1:

• d2qhbb1 is new in SCOP 1.75
  
• d2qhbb1 is called d2qhbb_ in SCOPe 2.01
  
• d2qhbb1 appears in the current release, SCOPe 2.08, called d2qhbb_