Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (19 families) consists only of helices |
Family a.4.1.3: Myb/SANT domain [46739] (15 proteins) |
Protein Telomere binding protein TBP1 [158244] (1 species) |
Species Tobacco (Nicotiana tabacum) [TaxId:4097] [158245] (2 PDB entries) Uniprot Q84ZU4 578-660 |
Domain d2qhba1: 2qhb A:578-659 [150786] automatically matched to 2CKX A:578-660 |
PDB Entry: 2qhb (more details), 2.4 Å
SCOP Domain Sequences for d2qhba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qhba1 a.4.1.3 (A:578-659) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} rpfsvaevealveavehlgtgrwrdvkmrafdnadhrtyvdlkdkwktlvhtasiapqqr rgepvpqdlldrvlaahaywsq
Timeline for d2qhba1: