SCOP 1.75: Domain d2qg2a1: 2qg2 A:17-223

Lineage for d2qg2a1 (2qg2 A:17-223)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein)

6. Protein HSP90 [55876] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55878] (45 PDB entries)
   Uniprot P08238 10-220 # HSP 90-beta isoform
   Uniprot P07900 16-223
   Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223

8. Domain d2qg2a1: 2qg2 A:17-223 [150756]
   automatically matched to d1byqa_
   complexed with a91

Details for d2qg2a1

PDB Entry: 2qg2, 1.8 Å

PDB Description: HSP90 complexed with A917985

PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOP Domain Sequences for d2qg2a1:

Sequence; same for both SEQRES and ATOM records:

>d2qg2a1 d.122.1.1 (A:17-223) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfve

Timeline for d2qg2a1:

• d2qg2a1 is new in SCOP 1.75
  
• d2qg2a1 is called d2qg2a_ in SCOPe 2.01
  
• d2qg2a1 appears in the current release, SCOPe 2.08, called d2qg2a_