Lineage for d2qfka1 (2qfk A:1-137)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758406Protein Dehaloperoxidase [46530] (1 species)
  7. 758407Species Amphitrite ornata [TaxId:129555] [46531] (3 PDB entries)
  8. 758408Domain d2qfka1: 2qfk A:1-137 [150738]
    automatically matched to d1ew6a_
    complexed with hem, nh4, so4

Details for d2qfka1

PDB Entry: 2qfk (more details), 1.62 Å

PDB Description: x-ray crystal structure analysis of the binding site in the ferric and oxyferrous forms of the recombinant heme dehaloperoxidase cloned from amphitrite ornata
PDB Compounds: (A:) Dehaloperoxidase A

SCOP Domain Sequences for d2qfka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qfka1 a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOP Domain Coordinates for d2qfka1:

Click to download the PDB-style file with coordinates for d2qfka1.
(The format of our PDB-style files is described here.)

Timeline for d2qfka1: