SCOPe 2.07: Domain d2qexv1: 2qex V:1-65

Lineage for d2qexv1 (2qex V:1-65)

1. Root: SCOPe 2.07

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein Prokaryotic (50S subunit) [58125] (3 species)

7. Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)

8. Domain d2qexv1: 2qex V:1-65 [150710]
   Other proteins in same PDB: d2qex21, d2qexb1, d2qexc1, d2qexf1, d2qexg1, d2qexh1, d2qexi1, d2qexk1, d2qexm1, d2qexp1, d2qexr1, d2qexs1, d2qexy1, d2qexz1
   automatically matched to d1w2bu_
   complexed with cd, cl, k, mg, na, neg

Details for d2qexv1

PDB Entry: 2qex, 2.9 Å

PDB Description: negamycin binds to the wall of the nascent chain exit tunnel of the 50s ribosomal subunit

PDB Compounds: (V:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d2qexv1:

Sequence; same for both SEQRES and ATOM records:

>d2qexv1 i.1.1.2 (V:1-65) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Timeline for d2qexv1:

• d2qexv1 first appeared in SCOP 1.75
  
• d2qexv1 appears in SCOPe 2.06
  
• d2qexv1 appears in the current release, SCOPe 2.08