Lineage for d2qejb2 (2qej B:343-450)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760553Protein Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha [89183] (1 species)
  7. 1760554Species Human (Homo sapiens) [TaxId:9606] [89184] (2 PDB entries)
  8. 1760558Domain d2qejb2: 2qej B:343-450 [150683]
    Other proteins in same PDB: d2qeja1, d2qejb1
    automatically matched to d1ow0a2
    complexed with ca, gol

Details for d2qejb2

PDB Entry: 2qej (more details), 3.2 Å

PDB Description: Crystal structure of a Staphylococcus aureus protein (SSL7) in complex with Fc of human IgA1
PDB Compounds: (B:) ig alpha-1 c region

SCOPe Domain Sequences for d2qejb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qejb2 b.1.1.2 (B:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]}
ntfrpevhllpppseelalnelvtltclargfspkdvlvrwlqgsqelprekyltwasrq
epsqgtttfavtsilrvaaedwkkgdtfscmvghealplaftqktidr

SCOPe Domain Coordinates for d2qejb2:

Click to download the PDB-style file with coordinates for d2qejb2.
(The format of our PDB-style files is described here.)

Timeline for d2qejb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qejb1