SCOP 1.75: Domain d2qdyb1: 2qdy B:1-211

Lineage for d2qdyb1 (2qdy B:1-211)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (4 families)

5. Family b.34.4.4: Nitrile hydratase beta chain [50101] (2 proteins)
   contains irregular array of helices in the N-terminal extension

6. Protein Iron-containing nitrile hydratase [50102] (1 species)

7. Species Rhodococcus erythropolis [TaxId:1833] [50103] (16 PDB entries)
   also Rhodococcus sp. R312

8. Domain d2qdyb1: 2qdy B:1-211 [150675]
   Other proteins in same PDB: d2qdya1
   automatically matched to d2ahjd_
   complexed with cl, fe, gol, ibn, mg

Details for d2qdyb1

PDB Entry: 2qdy, 1.3 Å

PDB Description: crystal structure of fe-type nhase from rhodococcus erythropolis aj270

PDB Compounds: (B:) Nitrile hydratase subunit beta

SCOP Domain Sequences for d2qdyb1:

Sequence; same for both SEQRES and ATOM records:

>d2qdyb1 b.34.4.4 (B:1-211) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevryvve
rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
hvkfaaeelfgsdtdggsvvvdlfegylepa

Timeline for d2qdyb1:

• d2qdyb1 is new in SCOP 1.75
  
• d2qdyb1 is called d2qdyb_ in SCOPe 2.01
  
• d2qdyb1 appears in the current release, SCOPe 2.08, called d2qdyb_