SCOPe 2.06: Domain d2qdya_: 2qdy A:

Lineage for d2qdya_ (2qdy A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
   4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets

4. Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families)
   duplication: contains two structural repeats

5. Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
   automatically mapped to Pfam PF02979

6. Protein automated matches [190256] (6 species)
   not a true protein

7. Species Actinomycete (Rhodococcus erythropolis) [187295] (1 PDB entry)

8. Domain d2qdya_: 2qdy A: [150674]
   Other proteins in same PDB: d2qdyb_
   automated match to d2ahja_
   complexed with cl, fe, gol, ibn, mg

Details for d2qdya_

PDB Entry: 2qdy, 1.3 Å

PDB Description: crystal structure of fe-type nhase from rhodococcus erythropolis aj270

PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d2qdya_:

Sequence; same for both SEQRES and ATOM records:

>d2qdya_ d.149.1.1 (A:) automated matches {Actinomycete (Rhodococcus erythropolis)}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvpt

Timeline for d2qdya_:

• d2qdya_ first appeared in SCOP 1.75, called d2qdya1
  
• d2qdya_ appears in SCOPe 2.05
  
• d2qdya_ appears in SCOPe 2.07
  
• d2qdya_ appears in the current release, SCOPe 2.08