Lineage for d2qbjt1 (2qbj T:2-86)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1081581Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1081715Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 1081716Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 1081717Protein Ribosomal protein S20 [46994] (2 species)
  7. 1081718Species Escherichia coli [TaxId:562] [158365] (26 PDB entries)
    Uniprot P0A7U7 2-86
  8. 1081738Domain d2qbjt1: 2qbj T:2-86 [150614]
    Other proteins in same PDB: d2qbjb1, d2qbjc1, d2qbjc2, d2qbjd1, d2qbje1, d2qbje2, d2qbjf1, d2qbjg1, d2qbjh1, d2qbji1, d2qbjj1, d2qbjk1, d2qbjl1, d2qbjm1, d2qbjn1, d2qbjp1, d2qbjq1, d2qbjr1, d2qbjs1, d2qbju1
    automatically matched to 2AVY T:2-86
    protein/RNA complex; complexed with lll, mg

Details for d2qbjt1

PDB Entry: 2qbj (more details), 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (T:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2qbjt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbjt1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]}
niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa
akglihknkaarhkanltaqinkla

SCOPe Domain Coordinates for d2qbjt1:

Click to download the PDB-style file with coordinates for d2qbjt1.
(The format of our PDB-style files is described here.)

Timeline for d2qbjt1: