Lineage for d2qbjk1 (2qbj K:12-128)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1172773Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 1172774Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 1172864Protein Ribosomal protein S11 [53141] (2 species)
  7. 1172865Species Escherichia coli [TaxId:562] [159644] (24 PDB entries)
    Uniprot P0A7R9 12-128
  8. 1172885Domain d2qbjk1: 2qbj K:12-128 [150606]
    Other proteins in same PDB: d2qbjb1, d2qbjc1, d2qbjc2, d2qbjd1, d2qbje1, d2qbje2, d2qbjf1, d2qbjg1, d2qbjh1, d2qbji1, d2qbjj1, d2qbjl1, d2qbjm1, d2qbjn1, d2qbjp1, d2qbjq1, d2qbjr1, d2qbjs1, d2qbjt1, d2qbju1
    automatically matched to 2AVY K:12-128
    protein/RNA complex; complexed with lll, mg

Details for d2qbjk1

PDB Entry: 2qbj (more details), 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d2qbjk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbjk1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]}
rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv

SCOPe Domain Coordinates for d2qbjk1:

Click to download the PDB-style file with coordinates for d2qbjk1.
(The format of our PDB-style files is described here.)

Timeline for d2qbjk1: