Lineage for d2qbjf1 (2qbj F:1-100)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1206291Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1206292Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1206293Protein Ribosomal protein S6 [54997] (4 species)
  7. 1206296Species Escherichia coli [TaxId:562] [160317] (24 PDB entries)
    Uniprot P02358 1-100
  8. 1206316Domain d2qbjf1: 2qbj F:1-100 [150601]
    Other proteins in same PDB: d2qbjb1, d2qbjc1, d2qbjc2, d2qbjd1, d2qbje1, d2qbje2, d2qbjg1, d2qbjh1, d2qbji1, d2qbjj1, d2qbjk1, d2qbjl1, d2qbjm1, d2qbjn1, d2qbjp1, d2qbjq1, d2qbjr1, d2qbjs1, d2qbjt1, d2qbju1
    automatically matched to 2AVY F:1-100
    protein/RNA complex; complexed with lll, mg

Details for d2qbjf1

PDB Entry: 2qbj (more details), 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2qbjf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbjf1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]}
mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
lmnveapqevidelettfrfndavirsmvmrtkhavteas

SCOPe Domain Coordinates for d2qbjf1:

Click to download the PDB-style file with coordinates for d2qbjf1.
(The format of our PDB-style files is described here.)

Timeline for d2qbjf1: