Lineage for d1ltw__ (1ltw -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (17 proteins) Protein Myoglobin [46469] (9 species) Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (131 PDB entries) 
Domain d1ltw__: 1ltw - [15060]
Details for d1ltw__
PDB Entry: 1ltw (more details), 1.7 Å
PDB Description: recombinant sperm whale myoglobin 29w mutant (oxy)
SCOP Domain Sequences for d1ltw__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ltw__ a.1.1.2 (-) Myoglobin {Sperm whale (Physeter catodon)}
mvlsegewqlvlhvwakveadvaghgqdiwirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg
SCOP Domain Coordinates for d1ltw__:
Click to download the PDB-style file with coordinates for d1ltw__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ltw__:
- d1ltw__ first appeared (with stable ids) in SCOP 1.55
- d1ltw__ appears in SCOP 1.59
- d1ltw__ appears in the current release, SCOPe 2.08, called d1ltwa_
View in 3D