Lineage for d2qbi61 (2qbi 6:1-185)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563701Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 2563746Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) (S)
    automatically mapped to Pfam PF01765
  5. 2563747Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)
  6. 2563748Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 2563764Species Thermus thermophilus [TaxId:274] [55198] (9 PDB entries)
  8. 2563770Domain d2qbi61: 2qbi 6:1-185 [150566]
    Other proteins in same PDB: d2qbi01, d2qbi11, d2qbi31, d2qbi41, d2qbic1, d2qbic2, d2qbid1, d2qbie1, d2qbif1, d2qbig1, d2qbig2, d2qbih1, d2qbih2, d2qbii1, d2qbii2, d2qbij1, d2qbik1, d2qbil1, d2qbim1, d2qbin1, d2qbio1, d2qbip1, d2qbiq1, d2qbir1, d2qbis1, d2qbit1, d2qbiu1, d2qbiv1, d2qbiw1, d2qbix1, d2qbiy1, d2qbiz1
    protein/RNA complex; complexed with lll, mg, zn
    protein/RNA complex; complexed with lll, mg, zn

Details for d2qbi61

PDB Entry: 2qbi (more details), 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 50S subunit of the first 70S ribosome, with gentamicin and RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (6:) 50S ribosomal protein RRF

SCOPe Domain Sequences for d2qbi61:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbi61 d.67.3.1 (6:1-185) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]}
mtlkelyaetrshmqkslevlehnlaglrtgranpalllhlkveyygahvplnqiatvta
pdprtlvvqswdqnalkaiekairdsdlglnpsnkgdalyinipplteerrkdlvravrq
yaeegrvairnirrealdklkklakelhlsedetkraeaeiqkitdefiakadqlaekke
qeilg

SCOPe Domain Coordinates for d2qbi61:

Click to download the PDB-style file with coordinates for d2qbi61.
(The format of our PDB-style files is described here.)

Timeline for d2qbi61: