SCOP 1.75: Domain d2qbhu1: 2qbh U:3-53

Lineage for d2qbhu1 (2qbh U:3-53)

1. Root: SCOP 1.75

2. Class j: Peptides [58231] (121 folds)

3. Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family)

5. Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
   Pfam PF01165

6. Protein Ribosomal protein S21, RpsU [161310] (1 species)

7. Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
   Uniprot P68679 4-54

8. Domain d2qbhu1: 2qbh U:3-53 [150561]
   Other proteins in same PDB: d2qbhb1, d2qbhc1, d2qbhc2, d2qbhd1, d2qbhe1, d2qbhe2, d2qbhf1, d2qbhg1, d2qbhh1, d2qbhi1, d2qbhj1, d2qbhk1, d2qbhl1, d2qbhm1, d2qbhn1, d2qbhp1, d2qbhq1, d2qbhr1, d2qbhs1, d2qbht1
   automatically matched to 2AVY U:3-53
   complexed with lll, mg

Details for d2qbhu1

PDB Entry: 2qbh, 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (U:) 30S ribosomal protein S21

SCOP Domain Sequences for d2qbhu1:

Sequence; same for both SEQRES and ATOM records:

>d2qbhu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

Timeline for d2qbhu1:

• d2qbhu1 is new in SCOP 1.75
  
• d2qbhu1 appears in SCOPe 2.01
  
• d2qbhu1 appears in the current release, SCOPe 2.08