Lineage for d2qbhp1 (2qbh P:1-82)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023011Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 1023012Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 1023013Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 1023014Protein Ribosomal protein S16 [54567] (3 species)
  7. 1023017Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
    Uniprot P0A7T3 1-82
  8. 1023036Domain d2qbhp1: 2qbh P:1-82 [150556]
    Other proteins in same PDB: d2qbhb1, d2qbhc1, d2qbhc2, d2qbhd1, d2qbhe1, d2qbhe2, d2qbhf1, d2qbhg1, d2qbhh1, d2qbhi1, d2qbhj1, d2qbhk1, d2qbhl1, d2qbhm1, d2qbhn1, d2qbhq1, d2qbhr1, d2qbhs1, d2qbht1, d2qbhu1
    automatically matched to 2AVY P:1-82
    protein/RNA complex; complexed with lll, mg

Details for d2qbhp1

PDB Entry: 2qbh (more details), 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2qbhp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbhp1 d.27.1.1 (P:1-82) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikevnkaa

SCOPe Domain Coordinates for d2qbhp1:

Click to download the PDB-style file with coordinates for d2qbhp1.
(The format of our PDB-style files is described here.)

Timeline for d2qbhp1: