SCOP 1.75: Domain d2qbhe1: 2qbh E:78-158

Lineage for d2qbhe1 (2qbh E:78-158)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Escherichia coli [TaxId:562] [159906] (24 PDB entries)
   Uniprot P0A7W1 78-158

8. Domain d2qbhe1: 2qbh E:78-158 [150545]
   Other proteins in same PDB: d2qbhb1, d2qbhc1, d2qbhc2, d2qbhd1, d2qbhe2, d2qbhf1, d2qbhg1, d2qbhh1, d2qbhi1, d2qbhj1, d2qbhk1, d2qbhl1, d2qbhm1, d2qbhn1, d2qbhp1, d2qbhq1, d2qbhr1, d2qbhs1, d2qbht1, d2qbhu1
   automatically matched to 2AVY E:78-158
   complexed with lll, mg

Details for d2qbhe1

PDB Entry: 2qbh, 4 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin and ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d2qbhe1:

Sequence; same for both SEQRES and ATOM records:

>d2qbhe1 d.14.1.1 (E:78-158) Ribosomal protein S5, C-terminal domain {Escherichia coli [TaxId: 562]}
gtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakaygstnpinvvr
atidglenmnspemvaakrgk

Timeline for d2qbhe1:

• d2qbhe1 is new in SCOP 1.75
  
• d2qbhe1 appears in SCOPe 2.01
  
• d2qbhe1 appears in the current release, SCOPe 2.08