![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
![]() | Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) ![]() common motif in otherwise different folds |
![]() | Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
![]() | Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
![]() | Species Escherichia coli [TaxId:562] [160439] (26 PDB entries) Uniprot P0A7V8 1-205 |
![]() | Domain d2qbhd1: 2qbh D:1-205 [150544] Other proteins in same PDB: d2qbhb1, d2qbhc1, d2qbhc2, d2qbhe1, d2qbhe2, d2qbhf1, d2qbhg1, d2qbhh1, d2qbhi1, d2qbhj1, d2qbhk1, d2qbhl1, d2qbhm1, d2qbhn1, d2qbhp1, d2qbhq1, d2qbhr1, d2qbhs1, d2qbht1, d2qbhu1 automatically matched to 2AVY D:1-205 protein/RNA complex; complexed with lll, mg |
PDB Entry: 2qbh (more details), 4 Å
SCOPe Domain Sequences for d2qbhd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbhd1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]} arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt fkrkpersdlsadinehlivelysk
Timeline for d2qbhd1: