SCOPe 2.02: Domain d2qbfu1: 2qbf U:3-53

Lineage for d2qbfu1 (2qbf U:3-53)

1. Root: SCOPe 2.02

2. Class j: Peptides [58231] (120 folds)

3. Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family)

5. Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
   Pfam PF01165

6. Protein Ribosomal protein S21, RpsU [161310] (1 species)

7. Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
   Uniprot P68679 4-54

8. Domain d2qbfu1: 2qbf U:3-53 [150507]
   Other proteins in same PDB: d2qbfb1, d2qbfc1, d2qbfc2, d2qbfd1, d2qbfe1, d2qbfe2, d2qbff1, d2qbfg1, d2qbfh1, d2qbfi1, d2qbfj1, d2qbfk1, d2qbfl1, d2qbfm1, d2qbfn1, d2qbfp1, d2qbfq1, d2qbfr1, d2qbfs1, d2qbft1
   automatically matched to 2AVY U:3-53
   protein/RNA complex; complexed with mg

Details for d2qbfu1

PDB Entry: 2qbf, 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2qbfu1:

Sequence; same for both SEQRES and ATOM records:

>d2qbfu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

Timeline for d2qbfu1:

• d2qbfu1 first appeared in SCOP 1.75
  
• d2qbfu1 appears in SCOPe 2.01
  
• d2qbfu1 appears in SCOPe 2.03
  
• d2qbfu1 appears in the current release, SCOPe 2.08