Lineage for d110ma_ (110m A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632833Protein Myoglobin [46469] (9 species)
  7. 632918Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (173 PDB entries)
  8. 632972Domain d110ma_: 110m A: [15050]
    complexed with hem, mnc, so4; mutant

Details for d110ma_

PDB Entry: 110m (more details), 1.77 Å

PDB Description: sperm whale myoglobin d122n methyl isocyanide at ph 9.0
PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d110ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d110ma_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d110ma_:

Click to download the PDB-style file with coordinates for d110ma_.
(The format of our PDB-style files is described here.)

Timeline for d110ma_: