Lineage for d2qbfi1 (2qbf I:3-129)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194044Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1194045Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1194046Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1194152Protein Ribosomal protein S9 [54218] (2 species)
  7. 1194153Species Escherichia coli [TaxId:562] [159907] (26 PDB entries)
    Uniprot P0A7X3 3-129
  8. 1194156Domain d2qbfi1: 2qbf I:3-129 [150496]
    Other proteins in same PDB: d2qbfb1, d2qbfc1, d2qbfc2, d2qbfd1, d2qbfe1, d2qbfe2, d2qbff1, d2qbfg1, d2qbfh1, d2qbfj1, d2qbfk1, d2qbfl1, d2qbfm1, d2qbfn1, d2qbfp1, d2qbfq1, d2qbfr1, d2qbfs1, d2qbft1, d2qbfu1
    automatically matched to 2AVY I:3-129
    protein/RNA complex; complexed with mg

Details for d2qbfi1

PDB Entry: 2qbf (more details), 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d2qbfi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbfi1 d.14.1.1 (I:3-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]}
nqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldl
yitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarr
rpqfskr

SCOPe Domain Coordinates for d2qbfi1:

Click to download the PDB-style file with coordinates for d2qbfi1.
(The format of our PDB-style files is described here.)

Timeline for d2qbfi1: