Lineage for d2qbfg1 (2qbf G:2-151)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1092301Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1092302Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1092303Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1092304Protein Ribosomal protein S7 [47975] (4 species)
  7. 1092307Species Escherichia coli [TaxId:562] [158599] (24 PDB entries)
    Uniprot P02359 2-151
  8. 1092310Domain d2qbfg1: 2qbf G:2-151 [150494]
    Other proteins in same PDB: d2qbfb1, d2qbfc1, d2qbfc2, d2qbfd1, d2qbfe1, d2qbfe2, d2qbff1, d2qbfh1, d2qbfi1, d2qbfj1, d2qbfk1, d2qbfl1, d2qbfm1, d2qbfn1, d2qbfp1, d2qbfq1, d2qbfr1, d2qbfs1, d2qbft1, d2qbfu1
    automatically matched to 2AVY G:2-151
    protein/RNA complex; complexed with mg

Details for d2qbfg1

PDB Entry: 2qbf (more details), 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 30S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d2qbfg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbfg1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]}
rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf
evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan
elsdaaenkgtavkkredvhrmaeankafa

SCOPe Domain Coordinates for d2qbfg1:

Click to download the PDB-style file with coordinates for d2qbfg1.
(The format of our PDB-style files is described here.)

Timeline for d2qbfg1: