![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily) beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123 |
![]() | Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) ![]() |
![]() | Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins) Pfam PF03946 |
![]() | Protein Ribosomal protein L11, N-terminal domain [54749] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [160201] (29 PDB entries) Uniprot P0A7J7 1-72 |
![]() | Domain d2qbei2: 2qbe I:1-72 [150469] Other proteins in same PDB: d2qbe01, d2qbe11, d2qbe31, d2qbe41, d2qbe61, d2qbec1, d2qbec2, d2qbed1, d2qbee1, d2qbef1, d2qbeg1, d2qbeg2, d2qbeh1, d2qbeh2, d2qbei1, d2qbej1, d2qbek1, d2qbel1, d2qbem1, d2qben1, d2qbeo1, d2qbep1, d2qbeq1, d2qber1, d2qbes1, d2qbet1, d2qbeu1, d2qbev1, d2qbew1, d2qbex1, d2qbey1, d2qbez1 automatically matched to 2AW4 I:1-72 complexed with mg, zn |
PDB Entry: 2qbe (more details), 3.3 Å
SCOP Domain Sequences for d2qbei2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbei2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]} akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv yadrsftfvtkt
Timeline for d2qbei2:
![]() Domains from other chains: (mouse over for more information) d2qbe01, d2qbe11, d2qbe31, d2qbe41, d2qbe61, d2qbec1, d2qbec2, d2qbed1, d2qbee1, d2qbef1, d2qbeg1, d2qbeg2, d2qbeh1, d2qbeh2, d2qbej1, d2qbek1, d2qbel1, d2qbem1, d2qben1, d2qbeo1, d2qbep1, d2qbeq1, d2qber1, d2qbes1, d2qbet1, d2qbeu1, d2qbev1, d2qbew1, d2qbex1, d2qbey1, d2qbez1 |