Lineage for d2qbeh2 (2qbe H:1-58)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967247Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2967248Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 2967249Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
    automatically mapped to Pfam PF01281
  6. 2967250Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 2967258Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
    Uniprot P0A7R1 1-58
  8. 2967261Domain d2qbeh2: 2qbe H:1-58 [150467]
    Other proteins in same PDB: d2qbe01, d2qbe11, d2qbe31, d2qbe41, d2qbe61, d2qbec1, d2qbec2, d2qbed1, d2qbee1, d2qbef1, d2qbeg1, d2qbeg2, d2qbeh1, d2qbei1, d2qbei2, d2qbej1, d2qbek1, d2qbel1, d2qbem1, d2qben1, d2qbeo1, d2qbep1, d2qbeq1, d2qber1, d2qbes1, d2qbet1, d2qbeu1, d2qbev1, d2qbew1, d2qbex1, d2qbey1, d2qbez1
    protein/RNA complex; complexed with mg, zn
    protein/RNA complex; complexed with mg, zn

Details for d2qbeh2

PDB Entry: 2qbe (more details), 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 50S subunit of the first 70S ribosome, with RRF bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2qbeh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbeh2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

SCOPe Domain Coordinates for d2qbeh2:

Click to download the PDB-style file with coordinates for d2qbeh2.
(The format of our PDB-style files is described here.)

Timeline for d2qbeh2: