![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) ![]() |
![]() | Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
![]() | Protein Ribosomal protein S20 [46994] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [158365] (26 PDB entries) Uniprot P0A7U7 2-86 |
![]() | Domain d2qbdt1: 2qbd T:2-86 [150452] Other proteins in same PDB: d2qbdb1, d2qbdc1, d2qbdc2, d2qbdd1, d2qbde1, d2qbde2, d2qbdf1, d2qbdg1, d2qbdh1, d2qbdi1, d2qbdj1, d2qbdk1, d2qbdl1, d2qbdm1, d2qbdn1, d2qbdp1, d2qbdq1, d2qbdr1, d2qbds1, d2qbdu1 automatically matched to 2AVY T:2-86 protein/RNA complex; complexed with mg |
PDB Entry: 2qbd (more details), 3.3 Å
SCOPe Domain Sequences for d2qbdt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbdt1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]} niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa akglihknkaarhkanltaqinkla
Timeline for d2qbdt1: