SCOPe 2.01: Domain d2spma_: 2spm A:

Lineage for d2spma_ (2spm A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (225 PDB entries)
   Uniprot P02185

8. Domain d2spma_: 2spm A: [15045]
   complexed with hem, so4; mutant

Details for d2spma_

PDB Entry: 2spm, 1.7 Å

PDB Description: a novel site-directed mutant of myoglobin with an unusually high o2 affinity and low autooxidation rate

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2spma_:

Sequence; same for both SEQRES and ATOM records:

>d2spma_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2spma_:

• d2spma_ first appeared (with stable ids) in SCOP 1.55, called d2spm__
  
• d2spma_ appears in SCOP 1.75
  
• d2spma_ appears in SCOPe 2.02
  
• d2spma_ appears in the current release, SCOPe 2.08