Lineage for d2qbdk1 (2qbd K:12-128)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2887539Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 2887540Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 2887630Protein Ribosomal protein S11 [53141] (2 species)
  7. 2887631Species Escherichia coli [TaxId:562] [159644] (24 PDB entries)
    Uniprot P0A7R9 12-128
  8. 2887634Domain d2qbdk1: 2qbd K:12-128 [150444]
    Other proteins in same PDB: d2qbdb1, d2qbdc1, d2qbdc2, d2qbdd1, d2qbde1, d2qbde2, d2qbdf1, d2qbdg1, d2qbdh1, d2qbdi1, d2qbdj1, d2qbdl1, d2qbdm1, d2qbdn1, d2qbdp1, d2qbdq1, d2qbdr1, d2qbds1, d2qbdt1, d2qbdu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2qbdk1

PDB Entry: 2qbd (more details), 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d2qbdk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbdk1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]}
rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv

SCOPe Domain Coordinates for d2qbdk1:

Click to download the PDB-style file with coordinates for d2qbdk1.
(The format of our PDB-style files is described here.)

Timeline for d2qbdk1: