![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) ![]() |
![]() | Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
![]() | Protein Ribosomal protein S10 [55001] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [160319] (24 PDB entries) Uniprot P0A7R5 5-102 |
![]() | Domain d2qbdj1: 2qbd J:5-102 [150443] Other proteins in same PDB: d2qbdb1, d2qbdc1, d2qbdc2, d2qbdd1, d2qbde1, d2qbde2, d2qbdf1, d2qbdg1, d2qbdh1, d2qbdi1, d2qbdk1, d2qbdl1, d2qbdm1, d2qbdn1, d2qbdp1, d2qbdq1, d2qbdr1, d2qbds1, d2qbdt1, d2qbdu1 automatically matched to 2AVY J:5-102 complexed with mg |
PDB Entry: 2qbd (more details), 3.3 Å
SCOP Domain Sequences for d2qbdj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbdj1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]} ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq yeirthlrlvdiveptektvdalmrldlaagvdvqisl
Timeline for d2qbdj1: