Lineage for d2qbdh1 (2qbd H:2-128)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2268317Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2268318Protein 70S ribosome functional complex [58121] (4 species)
  7. 2268319Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 2268322Domain d2qbdh1: 2qbd H:2-128 [150441]
    Other proteins in same PDB: d2qbdb1, d2qbdc1, d2qbdc2, d2qbdd1, d2qbde1, d2qbde2, d2qbdf1, d2qbdg1, d2qbdi1, d2qbdj1, d2qbdk1, d2qbdl1, d2qbdm1, d2qbdn1, d2qbdp1, d2qbdq1, d2qbdr1, d2qbds1, d2qbdt1, d2qbdu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2qbdh1

PDB Entry: 2qbd (more details), 3.3 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with ribosome recycling factor (RRF). This file contains the 30S subunit of the first 70S ribosome. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2qbdh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbdh1 i.1.1.1 (H:2-128) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelelt
lkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglg
geiicyv

SCOPe Domain Coordinates for d2qbdh1:

Click to download the PDB-style file with coordinates for d2qbdh1.
(The format of our PDB-style files is described here.)

Timeline for d2qbdh1: