Class a: All alpha proteins [46456] (284 folds) |
Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) |
Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
Protein Ribosomal protein S7 [47975] (4 species) |
Species Escherichia coli [TaxId:562] [158599] (24 PDB entries) Uniprot P02359 2-151 |
Domain d2qbdg1: 2qbd G:2-151 [150440] Other proteins in same PDB: d2qbdb1, d2qbdc1, d2qbdc2, d2qbdd1, d2qbde1, d2qbde2, d2qbdf1, d2qbdh1, d2qbdi1, d2qbdj1, d2qbdk1, d2qbdl1, d2qbdm1, d2qbdn1, d2qbdp1, d2qbdq1, d2qbdr1, d2qbds1, d2qbdt1, d2qbdu1 automatically matched to 2AVY G:2-151 complexed with mg |
PDB Entry: 2qbd (more details), 3.3 Å
SCOP Domain Sequences for d2qbdg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbdg1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]} rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan elsdaaenkgtavkkredvhrmaeankafa
Timeline for d2qbdg1: