SCOP 1.73: Domain d2myea_: 2mye A:

Lineage for d2myea_ (2mye A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (173 PDB entries)

8. Domain d2myea_: 2mye A: [15044]
   complexed with enc, hem, so4

Details for d2myea_

PDB Entry: 2mye, 1.68 Å

PDB Description: high resolution x-ray structures of myoglobin-and hemoglobin-alkyl isocyanide complexes

PDB Compounds: (A:) myoglobin (ethyl isocyanide)

SCOP Domain Sequences for d2myea_:

Sequence; same for both SEQRES and ATOM records:

>d2myea_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2myea_:

• d2myea_ first appeared (with stable ids) in SCOP 1.55, called d2mye__
  
• d2myea_ was called d2mye__ in SCOP 1.71
  
• d2myea_ appears in SCOP 1.75
  
• d2myea_ appears in the current release, SCOPe 2.08