![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
![]() | Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) ![]() common motif in otherwise different folds |
![]() | Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
![]() | Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
![]() | Species Escherichia coli [TaxId:562] [160439] (26 PDB entries) Uniprot P0A7V8 1-205 |
![]() | Domain d2qbdd1: 2qbd D:1-205 [150436] Other proteins in same PDB: d2qbdb1, d2qbdc1, d2qbdc2, d2qbde1, d2qbde2, d2qbdf1, d2qbdg1, d2qbdh1, d2qbdi1, d2qbdj1, d2qbdk1, d2qbdl1, d2qbdm1, d2qbdn1, d2qbdp1, d2qbdq1, d2qbdr1, d2qbds1, d2qbdt1, d2qbdu1 automatically matched to 2AVY D:1-205 protein/RNA complex; complexed with mg |
PDB Entry: 2qbd (more details), 3.3 Å
SCOPe Domain Sequences for d2qbdd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbdd1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]} arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt fkrkpersdlsadinehlivelysk
Timeline for d2qbdd1: