Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143 |
Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) |
Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
Protein Ribosomal protein S3 C-terminal domain [54823] (2 species) |
Species Escherichia coli [TaxId:562] [160263] (24 PDB entries) Uniprot P0A7V3 106-206 |
Domain d2qbdc2: 2qbd C:106-206 [150435] Other proteins in same PDB: d2qbdb1, d2qbdc1, d2qbdd1, d2qbde1, d2qbde2, d2qbdf1, d2qbdg1, d2qbdh1, d2qbdi1, d2qbdj1, d2qbdk1, d2qbdl1, d2qbdm1, d2qbdn1, d2qbdp1, d2qbdq1, d2qbdr1, d2qbds1, d2qbdt1, d2qbdu1 automatically matched to 2AVY C:106-206 complexed with mg |
PDB Entry: 2qbd (more details), 3.3 Å
SCOP Domain Sequences for d2qbdc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbdc2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]} rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte wyregrvplhtlradidyntseahttygvigvkvwifkgei
Timeline for d2qbdc2: