SCOPe 2.01: Domain d2qbcc2: 2qbc C:61-124

Lineage for d2qbcc2 (2qbc C:61-124)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
   Uniprot P60422 3-124

8. Domain d2qbcc2: 2qbc C:61-124 [150406]
   Other proteins in same PDB: d2qbc01, d2qbc11, d2qbc31, d2qbc41, d2qbcc1, d2qbcd1, d2qbce1, d2qbcf1, d2qbcg1, d2qbcg2, d2qbch1, d2qbch2, d2qbci1, d2qbci2, d2qbcj1, d2qbck1, d2qbcl1, d2qbcm1, d2qbcn1, d2qbco1, d2qbcp1, d2qbcq1, d2qbcr1, d2qbcs1, d2qbct1, d2qbcu1, d2qbcv1, d2qbcw1, d2qbcx1, d2qbcy1, d2qbcz1
   automatically matched to 2AW4 C:61-124
   protein/RNA complex; complexed with lll, mg, zn

Details for d2qbcc2

PDB Entry: 2qbc, 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 50S subunit of the second 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2qbcc2:

Sequence; same for both SEQRES and ATOM records:

>d2qbcc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

Timeline for d2qbcc2:

• d2qbcc2 first appeared in SCOP 1.75
  
• d2qbcc2 appears in SCOPe 2.02
  
• d2qbcc2 appears in the current release, SCOPe 2.08