| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) ![]() |
| Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
| Protein Ribosomal protein S18 [46913] (2 species) |
| Species Escherichia coli [TaxId:562] [158351] (24 PDB entries) Uniprot P0A7T7 19-73 |
| Domain d2qbbr1: 2qbb R:19-73 [150397] Other proteins in same PDB: d2qbbb1, d2qbbc1, d2qbbc2, d2qbbd1, d2qbbe1, d2qbbe2, d2qbbf1, d2qbbg1, d2qbbh1, d2qbbi1, d2qbbj1, d2qbbk1, d2qbbl1, d2qbbm1, d2qbbn1, d2qbbp1, d2qbbq1, d2qbbs1, d2qbbt1, d2qbbu1 automatically matched to 2AVY R:19-73 complexed with lll, mg |
PDB Entry: 2qbb (more details), 3.54 Å
SCOP Domain Sequences for d2qbbr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbbr1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh
Timeline for d2qbbr1: