Lineage for d2qb9t1 (2qb9 T:2-86)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 908235Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 908369Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 908370Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 908371Protein Ribosomal protein S20 [46994] (2 species)
  7. 908372Species Escherichia coli [TaxId:562] [158365] (26 PDB entries)
    Uniprot P0A7U7 2-86
  8. 908385Domain d2qb9t1: 2qb9 T:2-86 [150346]
    Other proteins in same PDB: d2qb9b1, d2qb9c1, d2qb9c2, d2qb9d1, d2qb9e1, d2qb9e2, d2qb9f1, d2qb9g1, d2qb9h1, d2qb9i1, d2qb9j1, d2qb9k1, d2qb9l1, d2qb9m1, d2qb9n1, d2qb9p1, d2qb9q1, d2qb9r1, d2qb9s1, d2qb9u1
    automatically matched to 2AVY T:2-86
    protein/RNA complex; complexed with lll, mg

Details for d2qb9t1

PDB Entry: 2qb9 (more details), 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 30S subunit of the first 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (T:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2qb9t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qb9t1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]}
niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa
akglihknkaarhkanltaqinkla

SCOPe Domain Coordinates for d2qb9t1:

Click to download the PDB-style file with coordinates for d2qb9t1.
(The format of our PDB-style files is described here.)

Timeline for d2qb9t1: