Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) |
Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
Protein Ribosomal protein S18 [46913] (2 species) |
Species Escherichia coli [TaxId:562] [158351] (24 PDB entries) Uniprot P0A7T7 19-73 |
Domain d2qb9r1: 2qb9 R:19-73 [150344] Other proteins in same PDB: d2qb9b1, d2qb9c1, d2qb9c2, d2qb9d1, d2qb9e1, d2qb9e2, d2qb9f1, d2qb9g1, d2qb9h1, d2qb9i1, d2qb9j1, d2qb9k1, d2qb9l1, d2qb9m1, d2qb9n1, d2qb9p1, d2qb9q1, d2qb9s1, d2qb9t1, d2qb9u1 automatically matched to 2AVY R:19-73 complexed with lll, mg |
PDB Entry: 2qb9 (more details), 3.54 Å
SCOP Domain Sequences for d2qb9r1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qb9r1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]} eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh
Timeline for d2qb9r1: