Lineage for d2qb9l1 (2qb9 L:1-123)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541496Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1541757Protein Ribosomal protein S12 [50302] (2 species)
  7. 1541758Species Escherichia coli [TaxId:562] [159087] (25 PDB entries)
    Uniprot P0A7S3 1-123
  8. 1541771Domain d2qb9l1: 2qb9 L:1-123 [150339]
    Other proteins in same PDB: d2qb9b1, d2qb9c1, d2qb9c2, d2qb9d1, d2qb9e1, d2qb9e2, d2qb9f1, d2qb9g1, d2qb9h1, d2qb9i1, d2qb9j1, d2qb9k1, d2qb9m1, d2qb9n1, d2qb9p1, d2qb9q1, d2qb9r1, d2qb9s1, d2qb9t1, d2qb9u1
    automatically matched to 2AVY L:1-123
    protein/RNA complex; complexed with lll, mg

Details for d2qb9l1

PDB Entry: 2qb9 (more details), 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 30S subunit of the first 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d2qb9l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qb9l1 b.40.4.5 (L:1-123) Ribosomal protein S12 {Escherichia coli [TaxId: 562]}
atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
pka

SCOPe Domain Coordinates for d2qb9l1:

Click to download the PDB-style file with coordinates for d2qb9l1.
(The format of our PDB-style files is described here.)

Timeline for d2qb9l1: