Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) common motif in otherwise different folds |
Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
Species Escherichia coli [TaxId:562] [160439] (26 PDB entries) Uniprot P0A7V8 1-205 |
Domain d2qb9d1: 2qb9 D:1-205 [150330] Other proteins in same PDB: d2qb9b1, d2qb9c1, d2qb9c2, d2qb9e1, d2qb9e2, d2qb9f1, d2qb9g1, d2qb9h1, d2qb9i1, d2qb9j1, d2qb9k1, d2qb9l1, d2qb9m1, d2qb9n1, d2qb9p1, d2qb9q1, d2qb9r1, d2qb9s1, d2qb9t1, d2qb9u1 automatically matched to 2AVY D:1-205 protein/RNA complex; complexed with lll, mg |
PDB Entry: 2qb9 (more details), 3.54 Å
SCOPe Domain Sequences for d2qb9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qb9d1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]} arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt fkrkpersdlsadinehlivelysk
Timeline for d2qb9d1: